PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_5BL_C559EFC8A.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 193aa    MW: 21611.1 Da    PI: 7.419
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_5BL_C559EFC8A.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_141.23.5e-1391146358
                            XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                 bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevak 58 
                            e +r rr+ +NRe+ArrsR RK+ ++ eL  +v+ L + N++L +el++    +  
  Traes_5BL_C559EFC8A.1  91 EERRRRRMVSNRESARRSRMRKQRQLSELWARVAHLRGANRRLLDELNRAMRSCGD 146
                            67899*******************************************98887765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.6E-1389153IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.2E-989146No hitNo description
PfamPF001701.2E-1090145IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.64591154IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.21E-1093142No hitNo description
PROSITE patternPS00036096111IPR004827Basic-leucine zipper domain
CDDcd147028.56E-1698144No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 193 aa     Download sequence    Send to blast
MLHHYHHGEV ASLHCLSPPN PPFHTHYHHP GMIAAGMTPP PPFHFSPAAY EYEDEPMLQE  60
ALAAIGNNSP PGSGGAGDDI HGQVLASAAE EERRRRRMVS NRESARRSRM RKQRQLSELW  120
ARVAHLRGAN RRLLDELNRA MRSCGDVRRD NDRLSAEKAE LEARLEQLMQ QAQQSNNASS  180
EPCEKNTTVA AAE
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1105112RRSRMRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0043767e-77AP004376.3 Oryza sativa Japonica Group genomic DNA, chromosome 8, PAC clone:P0481F05.
GenBankAP0045577e-77AP004557.3 Oryza sativa Japonica Group genomic DNA, chromosome 8, PAC clone:P0028A08.
GenBankAP0149647e-77AP014964.1 Oryza sativa Japonica Group DNA, chromosome 8, cultivar: Nipponbare, complete sequence.
GenBankCP0126167e-77CP012616.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 8 sequence.
GenBankCT8315047e-77CT831504.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA115A07, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003576641.14e-68PREDICTED: DNA-binding protein EMBP-1-like
TrEMBLW5FHR91e-141W5FHR9_WHEAT; Uncharacterized protein
STRINGBRADI4G32920.11e-67(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP118635126
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G04038.11e-08basic leucine-zipper 48
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]